PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03898.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 254aa    MW: 29374 Da    PI: 8.9948
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03898.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.27.9e-50141341128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yL +kv+g +l++  vi+e+di+k+ePwdLp    + ++e yfFs+r+ ky++g+r+nr+t sgyWkat
  Rsa1.0_03898.1_g00007.1  14 LPPGFRFHPTDEELVVQYLSRKVSGLPLPA-YVIPEIDICKTEPWDLPG---GCDSERYFFSTREAKYPNGNRSNRSTGSGYWKAT 95 
                              79***************************9.89***************4...45789***************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g d+++ +   ++ g+kktLvfykg+ p+g++t+Wv+heyrl
  Rsa1.0_03898.1_g00007.1  96 GIDRQIGK---NVFGMKKTLVFYKGKPPNGTRTNWVLHEYRL 134
                              ******77...89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-588156IPR003441NAC domain
PROSITE profilePS5100556.23614156IPR003441NAC domain
PfamPF023652.6E-2615134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEKRSSIENR KMRLPPGFRF HPTDEELVVQ YLSRKVSGLP LPAYVIPEID ICKTEPWDLP  60
GGCDSERYFF STREAKYPNG NRSNRSTGSG YWKATGIDRQ IGKNVFGMKK TLVFYKGKPP  120
NGTRTNWVLH EYRLVDSQHG SYGENTNWVL CRVFLKNRSN NNSKKKENER EEKKEGRERD  180
DNKSTCPIFY DFLGNDVKNR RCCDLNLTRT FCCCSSSASS SVCSSALTQT SFNIDSDNHH  240
EEISCRENKF RLFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-511115917171NAC domain-containing protein 19
3swm_B3e-511115917171NAC domain-containing protein 19
3swm_C3e-511115917171NAC domain-containing protein 19
3swm_D3e-511115917171NAC domain-containing protein 19
3swp_A3e-511115917171NAC domain-containing protein 19
3swp_B3e-511115917171NAC domain-containing protein 19
3swp_C3e-511115917171NAC domain-containing protein 19
3swp_D3e-511115917171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756680.0KM975668.1 Brassica napus NAC transcription factor 41.1 (NAC41.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303076.11e-132NAC domain-containing protein 41-like
RefseqXP_009143857.11e-132PREDICTED: NAC domain-containing protein 68-like
SwissprotO227981e-110NAC41_ARATH; NAC domain-containing protein 41
TrEMBLA0A078FWR01e-132A0A078FWR0_BRANA; BnaA05g10110D protein
TrEMBLM4CMQ41e-132M4CMQ4_BRARP; Uncharacterized protein
STRINGBra005492.1-P1e-131(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18062786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.11e-103NAC domain containing protein 41